PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_11581.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 476aa    MW: 53701.9 Da    PI: 5.4386
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_11581.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-142569348
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              W++eEd++l + ++++G+++W+ Ia+ +   ++  qc+ rw++yl
  Rsa1.0_11581.1_g00001.1 25 TWSQEEDDILRKQITLHGTDNWAIIASNFS-DKSTRQCRRRWYTYL 69
                             6*****************************.*************97 PP

2Myb_DNA-binding43.48e-1475118146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
  Rsa1.0_11581.1_g00001.1  75 RGGWSPEEDTLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 118
                              789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1661869IPR017930Myb domain
SMARTSM007175.4E-132271IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-2522116IPR009057Homeodomain-like
CDDcd001671.78E-122569No hitNo description
Gene3DG3DSA:1.10.10.607.8E-192677IPR009057Homeodomain-like
PfamPF139215.2E-152686No hitNo description
PROSITE profilePS5129420.47570124IPR017930Myb domain
SMARTSM007172.5E-1474122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-1978123IPR009057Homeodomain-like
CDDcd001671.79E-1078119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MEETTERKKK VNNDDSKKKE RHIVTWSQEE DDILRKQITL HGTDNWAIIA SNFSDKSTRQ  60
CRRRWYTYLN SDFKRGGWSP EEDTLLCEAQ RVFGNRWTEI AKVVSGRTDN AVKNRFTTLC  120
KKRAKYEEAM AAKDNNNNRI ASCVNSNNKR MLLPDCGIST PQKAETHSPL SKKIRRSDVP  180
DVTVFGGYGD RSHIKVNPDV NQPLYGDRSH IKVVNQQIRP PFSVLPHIGD EKKNQTCNAK  240
ESEGEDKGKD DPKVTCLMQQ AELLSSLAQK VNADNTEKSM ENAWKVLQDF FNKSKENDVF  300
RYGLPDIDYQ LEEFKDLVED LRISNEDSQA SWRQPDLHDS PASSDYSSGS TAMPHSSGDQ  360
TKQPMSGSQT ETQELNPGEL LPPASDATVE QVDLLSTCQD VLENPNEIMP MSVEEEFKSP  420
VQVTPLFRSL AAGIPSPQFS ESERNFVLKT LGVESPCPSA NLSQPPPCKR VLLDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-242612310107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756580.0KM975658.1 Brassica napus MYB transcription factor 88.1 (MYB88.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009101234.10.0PREDICTED: transcription factor RAX2-like
TrEMBLM4E7P80.0M4E7P8_BRARP; Uncharacterized protein
STRINGBra024804.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88